A practical reference on SR9009: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-06-07 and is reviewed periodically as new material appears.
SR9009 is frequently discussed alongside other REV-ERB ligands, including synthetic agonists and natural heme-related molecules. Its selectivity for REV-ERB over related nuclear receptors has been measured in binding and reporter assays, though off-target activity at higher concentrations is possible. The compound is prohibited in sport by the World Anti-Doping Agency, and it is not approved for any medical use in major jurisdictions. Products sold online may be labeled as research chemicals, and their identity and purity are not guaranteed by regulatory review.
SR9009 is a synthetic small molecule that acts on the nuclear receptors REV-ERBα and REV-ERBβ. These receptors are part of the circadian clock machinery and normally repress transcription of certain target genes. In laboratory research, SR9009 is used as a chemical tool to study how REV-ERB activity influences metabolism, inflammation, and daily biological rhythms. The compound is not an approved medicine, and its effects in humans remain largely uncharacterized. It is often described as an investigational agent rather than a therapeutic product.
REV-ERB proteins typically suppress gene expression by recruiting corepressor complexes to DNA response elements. SR9009 binds these receptors and strengthens that repressive action in cell-based assays. Studies in rodents have reported changes in lipid handling, mitochondrial function, and exercise capacity after treatment. Such findings are often cited as evidence for metabolic effects, but species differences and limited pharmacokinetic data make direct translation to humans uncertain. Researchers continue to examine which effects are robust and which depend on specific experimental conditions.
Stability depends on physical form, temperature, light exposure, and solvent. Solid SR9009 is generally stored cold and dry, with protection from light to limit degradation. Dimethyl sulfoxide stocks are common for laboratory work, but repeated freeze-thaw cycles can reduce compound integrity. Aqueous solutions may be less stable than organic stocks, and the ethyl ester in the structure can be susceptible to hydrolysis under certain conditions. Researchers typically validate storage conditions and recheck purity before quantitative experiments, especially when using archived material.
Regulatory treatment of SR9009 varies by country and region. It is not approved as a pharmaceutical, and several jurisdictions restrict its sale for human consumption. Some authorities classify it as a research chemical, a prescription-only substance, or a prohibited performance-enhancing agent in sport. Purchasers may encounter certificates of analysis, but these documents do not guarantee identity, purity, or legality. In research settings, institutional safety reviews and controlled procurement help ensure that materials are handled under appropriate oversight. The absence of harmonized rules means that legal status can change and requires verification.
| Property | Value | Notes |
|---|---|---|
| Common name | SR9009 | Also marketed informally as Stenabolic |
| Chemical class | Synthetic REV-ERB agonist | Binds REV-ERBα and REV-ERBβ |
| Molecular formula | C24H30ClN3O4S | Approximate molecular weight 492 g/mol |
| CAS Registry Number | 1379686-30-2 | Identifier for the parent compound |
| Regulatory status | Not approved for human use | Prohibited in sport by WADA |
Analytical chemists detect SR9009 with liquid chromatography-tandem mass spectrometry, commonly abbreviated LC-MS/MS. Sample preparation may involve protein precipitation, liquid-liquid extraction, or solid-phase extraction before analysis. Laboratories can target the parent compound or its metabolites, depending on the matrix and the purpose of testing. Anti-doping methods require sensitive and specific assays because concentrations in biological samples can be low. Reference standards and validated methods are essential for reliable identification and quantification.
Regulatory agencies have not approved SR9009 for human therapeutic use. It is typically sold as a research chemical with labels stating that it is not for human consumption. The World Anti-Doping Agency prohibits the substance in sport, generally under the category of non-approved substances. Customs and national laws may restrict importation, sale, or possession. Product quality and legal status can vary by country and vendor, and therapeutic claims are not permitted in regulated advertising because the compound lacks approval.
In laboratory settings, SR9009 is commonly identified by its molecular structure and its interaction with REV-ERB receptors. Vendors may list it under synonyms such as Stenabolic or REV-ERB agonist, but those names do not define purity or identity. Analytical confirmation typically uses high-performance liquid chromatography with ultraviolet detection or liquid chromatography–mass spectrometry. A reference standard is needed to compare retention time and mass spectrum, because the compound can be confused with related research chemicals.
Handling practices for SR9009 focus on minimizing degradation and contamination. The solid is generally stored desiccated at or below -20 °C, protected from light and moisture. Stock solutions are often prepared in dimethyl sulfoxide or ethanol, then aliquoted to avoid repeated freeze–thaw cycles. Aqueous solubility is low, so formulations for animal studies may require cosolvents or suspending agents. Personnel should follow institutional chemical safety procedures, because toxicological data for humans are incomplete.
Regulatory status varies by country and intended use. Major drug agencies have not granted marketing authorization for SR9009 as a medicine, and it is not listed as a controlled substance in many jurisdictions. It is often sold as a research chemical, a category that may fall outside pharmaceutical manufacturing rules. Buyers should verify local laws and supplier documentation, including certificates of analysis. The lack of standardized quality controls raises concerns about identity, purity, and actual content in products marketed online.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
=== Photochromic compounds === Photochromic compounds have the ability to switch between a range or variety of colors. Their ability to display different colors lies in how they absorb light. Different isomeric manifestations of the molecule absorbs different wavelengths of light, so that each isomeric species can display a different color based on its absorption. These include photoswitchable compounds, which are proteins that can switch from a non-fluorescent state to that of a fluorescent one given a certain environment. The most common organic molecule to be used as a photochrome is diarylethene. Other examples of photoswitchable proteins include PADRON-C, rs-FastLIME-s and bs-DRONPA-s, which can be used in plant and mammalian cells alike to watch cells move into different environments.
The first step was witnessed on live television by at least one-fifth of the population of Earth, or about 723 million people. His first words when he stepped off the LM's landing footpad were, "That's one small step for [a] man, one giant leap for mankind." Aldrin joined him on the surface almost 20 minutes later. Altogether, they spent just under two and one-quarter hours outside their craft. The next day, they performed the first crewed launch from another celestial body, and rendezvoused back with Collins in Columbia. But before they return ascended the Space Race came to a particular culmination. A few days before Apollo 11 left Earth, the Soviet Union launched the Luna 15 probe, entering lunar orbit just before Apollo 11 and eventually sharing it with Apollo 11. Aware of Luna 15, Apollo 8 astronaut Frank Borman was asked to use his goodwill contacts in the Soviet Union to prevent any collision. Subsequently, in one of the first instances of Soviet–American space communication the Soviet Union released Luna 15's flight plan to ensure it would not collide with Apollo 11, although its exact mission was not publicized. But as Apollo 11 was wrapping up surface activities, the Soviet mission command hastened Luna 15 and attempted its robotic sample-return mission before Apollo 11 would return. As Luna 15 descended just two hours before Apollo 11's launch and impacted at 15:50 UTC some hundred kilometers away from Apollo 11, British astronomers monitoring Luna 15 recorded the situation, with one commenting:"I say, this has really been drama of the highest order".
==== Infection ==== The possibility that infectious agents cause Alzheimer's disease has been considered since the early 20th century, when Oskar Fischer likened amyloid plaques to small masses (called 'Drusen') of a microbe called actinomyces. Since then, at least 15 different agents, including bacteria, viruses, fungi and protozoa, have been proposed to cause Alzheimer's disease. No definitive evidence has been presented that a specific infectious agent is necessary and sufficient to cause Alzheimer's disease. However, it is possible that microbial infections might act as risk factors for the disease. For example, human herpes viruses such as HSV-1, HHV-6, and HHV-7 have been linked to the risk of Alzheimer's disease. In addition, some pathogens have been reported to seed Aβ deposition in the brain, and aggregated Aβ has antimicrobial properties, suggesting that Aβ plaques might form when brain cells generate Aβ to fight infection. Researchers caution that brain infections can cause dementia by mechanisms unrelated to Alzheimer's disease.
Sources: en.wikipedia.org
==== Support for Bashar al-Assad ==== Galloway supported the Syrian occupation of Lebanon, telling the Lebanese Daily Star in August 2008: "Syrian troops in Lebanon maintain stability and protect the country from Israel". In the same article he expressed his opposition to United Nations Security Council Resolution 1559, which urged the Lebanese Government to establish control over all its territory. When Syria did withdraw from Lebanon, Galloway objected and said the occupation had been entirely "legal"; Christopher Hitchens, citing the Taif Accords of 1989, disputed his comment. Referring to Syrian president Bashar al-Assad, Galloway said during a visit to the University of Damascus in November 2005: "For me he is the last Arab ruler, and Syria is the last Arab country. It is the fortress of the remaining dignity of the Arabs". He also called Assad a "breath of fresh air". Galloway again praised the government of Assad in a leaked 2010 email to Assad's advisor Bouthaina Shaaban when asking for help in a Viva Palestina convoy, and reminded her of previous help from the Syrian government for the campaign. In the correspondence, leaked by the Anonymous hacking group, she responded: "God bless your amazing efforts and I will be honoured to be part and parcel of it". "I knew that I could rely on you and the last Arab country in this historic endeavour", Galloway wrote in response. Galloway said in a July 2011 interview on Hezbollah's Al-Manar station: "Bashar Assad wants reform and change, to realise the aspirations of his people".
Josephine Bunch is a fellow at the National Physical Laboratory. She is Chair of Biomolecular Mass Spectrometry at Imperial College London and the co-director of the National Centre of Excellence in Mass Spectrometry Imaging.
In 2008, Guinness World Records awarded Half-Life 2 the records for "Highest-rated Shooter by PC Gamer" and "First game to feature a gravity gun". In 2009, Game Informer named Half-Life 2 the fifth-best game, writing that "Valve redefined the way first-person shooters were created". Half-Life 2 was selected by readers of The Guardian as the best game of the decade, with particular praise for the environment design. The Guardian journalist Keith Stuart wrote that it "pushed the envelope for the genre, and set a new high watermark for FPS narrative". Half-Life 2 won Crispy Gamer's Game of the Decade tournament style poll. It also won Reviews on the Run's, IGN's Best Game of the Decade and Spike Video Game Awards 2012 Game of the Decade. In December 2021, IGN named Half-Life 2 the ninth-best game of all time.
Sources: en.wikipedia.org
== Research Contributions == GeneDx researchers have contributed to peer-reviewed publications in major scientific and medical journals, generating critical data to expand access to genomic testing. In 2020, GeneDx researchers co-authored a study published in Nature analyzing data from 31,058 exome trios to identify 28 previously undescribed genes associated with developmental disorders, providing diagnoses for approximately 500 families. A 2021 study in JAMA, using data from GeneDx, found that exome sequencing identified pathogenic or likely pathogenic variants in 32.7% of pediatric patients with cerebral palsy, providing evidence to support genetic testing guidelines for the condition. In 2025, GeneDx collaborated with Seattle Children's and the University of Washington on the SeqFirst research program, which produced two landmark publications. The SeqFirst-Neo study, published in the American Journal of Human Genetics, found that applying broad exclusion criteria for rapid genome sequencing in NICUs increased the odds of a precise genetic diagnosis ninefold compared to conventional care, with 42% of diagnosed infants having been missed under standard protocols. A companion study published in The Journal of Pediatrics demonstrated that implementing rapid genome sequencing as a first-tier test in non-critical pediatric inpatient wards reduced the average time to a precise genetic diagnosis from 289 days to 13 days.
== External links == WHO fact sheet on opioid overdose Community management of opioid overdose (PDF). World Health Organization. 2014. ISBN 978-92-4-154881-6. Archived from the original (PDF) on 1 September 2022.
== Further reading == Savulescu, Julian; Bostrom, Nick (2009). Human enhancement. Oxford: Oxford University Press. ISBN 978-0-19-929972-0. Savulescu, Julian; ter Meulen, Ruud; Kahane, Guy (2011). Enhancing human capacities. Chichester: Wiley-Blackwell. ISBN 978-1-4051-9581-2. Michael Bess (2015). Our Grandchildren Redesigned: Life in the Bioengineered Society of the Near Future. Beacon Press. ISBN 978-0-8070-5217-4. Bateman, Simone; Gayon, Jean; Allouche, Sylvie; Goffette, Jérôme; Marzano, Michela (2015). Inquiring into Human Enhancement: Interdisciplinary and International Perspectives (1 ed.). London: Palgrave Macmillan. ISBN 978-1-137-53006-6. Edwards, Gary (2016). "Enhancement". Encyclopedia of Global Bioethics. Springer International Publishing. pp. 1121–1130. doi:10.1007/978-3-319-09483-0_172. ISBN 978-3-319-09483-0. Jotterand, Fabrice; Ienca, Marcello (2024). The Routledge Handbook of the Ethics of Human Enhancement. New York: Routledge. ISBN 978-0-367-61579-6.
Sources: en.wikipedia.org
SR9009 is a synthetic research compound that binds and modulates the nuclear receptors REV-ERBα and REV-ERBβ. It is used in laboratory studies of circadian biology and metabolism, not as an approved medicine. It is also known by the informal name Stenabolic.
No. SR9009 has not been approved as a therapeutic drug in the United States, European Union, or other major markets. Human safety and efficacy data are very limited. Its presence in consumer products does not imply regulatory approval.
The World Anti-Doping Agency lists SR9009 as a prohibited substance because it can alter gene expression and metabolic pathways relevant to performance. The ban applies at all times, not only during competition. Detection relies on laboratory methods such as mass spectrometry.
The most common approach is liquid chromatography-tandem mass spectrometry, often after extraction from blood, urine, or tissue. Ultraviolet detection and nuclear magnetic resonance spectroscopy are used mainly for reference material characterization. Isotope-labeled internal standards improve accuracy.